DPCstruct | MC26356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3ZIY0 | 37-144 | REVNLCIGKEWYRFPNSFFLPENWQPQFIQSEFRGQLPKAYAAGEDGTKVVPTHMNDMNLEETSRYMDVRKCHYLVDLDLAGELPRE… |
| A0A0M3JLL5 | 1-94 | MTNIGHVKIQNTSSIHVCVGKEWYRFPSSFFLPNGVVDRRGRKWKTELNFVKSEFAGLLPKPFNEAFVLPNVTRIVPTEMNDLNKEE… |
| A0A1V9ZHC2 | 668-745 | None |
| S4RPU4 | 193-292 | None |
| A0A7E4W837 | 483-577 | None |
| A0A6U1P647 | 28-101 | None |
| A0A482SEA0 | 66-138 | None |
| A0A7J7MU54 | 1-109 | None |
| A0A2C5ZPI2 | 563-668 | None |
| A0A7R9ML67 | 87-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.