DPCstruct | MC26351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JIC4 | 1-111 | MWDAGSGWICVLMVGLAAGAVAGIIDIGARWMSDLKDGVCADRFWLDREHCCWSANDSVYKDADCSAWTSWPEMLQYYDKNIFYYFL… |
| A0A0F8D4M8 | 103-193 | YEAGQAWMVVTLIGMAIGMIAAIINIVSEWLSDIKIGHCKTAFYLNEEFCCWGEDNGCDAWENWSGFALINYLIYTFMAVSFALASA… |
| A0A068SEP3 | 1-87 | None |
| A0A0M3IRB9 | 150-258 | None |
| A0A1I8IKL6 | 110-221 | None |
| A0A1B7YPT9 | 180-275 | None |
| A0A7J7Z4H4 | 65-173 | None |
| A0A4W5KER9 | 67-173 | None |
| A0A6G0Z0W6 | 69-176 | None |
| A0A7R9PFD7 | 22-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.