DPCstruct | MC2635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1943 |
|---|---|
| Mean domain length (aa) | 156 ± 30 aa |
| Standard deviation of domain lengths | 30.32 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 11.20 |
| Pfam Score | 53.02 |
| Assigned Pfam label(s) | PF20569- CL0020- CL0105- CL0458- PF09839 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0M0R2 | 3-125 | SARPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRSRLPQQPGTAQEVQPAAWSALGIDAVVVGQVTPAPDGGYNVAYQLV… |
| A0A1V6HUF9 | 21-184 | KGTSRYQAPQANLGAIRTAAVLPFVTLTGDAAHAEKVQRIFLGELLALGAVEVVESGRVAQLAVREQLVNTEALTPADFTRIGRELG… |
| A0A1G1ACH9 | 25-161 | None |
| A0A3D0TJN8 | 13-183 | None |
| A0A7C0U1U3 | 21-180 | None |
| A0A1G2Y9A5 | 21-192 | None |
| A0A1V5ZBR0 | 61-212 | None |
| A0A423GNF9 | 58-191 | None |
| A0A1R4GFZ7 | 6-168 | None |
| A0A7W4BT93 | 28-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.