DPCstruct | MC26347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 61.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JHB4 | 17-72 | ICAHARYFSGTHSSTFSFRIHEDREILGFDPESTFNCLCPDGKPDCEQPAKWKIVY |
| A0A814CF87 | 161-223 | AIIDQWICAHARYFLGSYESTFSFRIQEDREIFGFEQDSTFNRLCGNNEGISCEKSTIWSIVY |
| A0A7R8W071 | 284-350 | None |
| A0A2H2J564 | 1-57 | None |
| A0A0N4WB06 | 97-168 | None |
| A0A6V7X4M9 | 44-120 | None |
| A0A4W2GAE5 | 426-488 | None |
| A0A0D8XTA6 | 334-397 | None |
| L8Y225 | 128-190 | None |
| A0A0B1S054 | 13-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.