DPCstruct | MC26345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369JTN4 | 403-473 | EAAPSPVVPADEDEAADQDVCWICAEPVKYYAVPECNHRTCHVCALRLRALYKKNDCTFCKDPQPSVIFTV |
| B0WT52 | 55-120 | RSSPSESSTSEANDSTCVVCFKPILIYAIGECDHLCCFECSARIRVLCRQNDCPICRRDLAKVIFA |
| A0A7J6U383 | 109-196 | None |
| A0A3S1A4I7 | 1-75 | None |
| A0A0E0LNK3 | 26-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.