DPCstruct | MC26344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 7.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.98 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | PF00200- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183FBG8 | 132-194 | LVNYGNRVPTRVSQLTLAHEIGHNFGSPHDFPLECQPGLPDGNFIMFASATSGDKVNNAKFSP |
| A0A0M3JFJ2 | 2-69 | SSAKTTQGGTVITREADLVTAHEFGHNWGAVHDDFSSECSPSYSQGGSFIMHTFAVSGYDANNNFMAL |
| A0A1B0B6Q9 | 47-117 | None |
| A0A1X7ST77 | 124-188 | None |
| A0A183MBJ5 | 43-117 | None |
| A0A6A4JVU2 | 58-131 | None |
| A0A834NN49 | 120-172 | None |
| A0A5B7DKL8 | 272-334 | None |
| A0A811LGU7 | 236-301 | None |
| A0A7M3VJN3 | 157-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.