DPCstruct | MC26343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 162 ± 23 aa |
| Standard deviation of domain lengths | 22.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C1CYZ4 | 241-380 | LADFFVMRWNRERNGEMEVPPERRLNEAIRKRFVLCLRDVIFMGIYAKSGTAMSYSLSTLQALAFLEPDLILPGALQRIYPSMQGLV… |
| A0A821V461 | 1-171 | MRIIYRDFRSERKVRPFWFFIPHEAYRLTEQDITDFVNCIKEYAFISIFNKDHNKEAAEACQYLSMLRPELIVPSLVEQLFSSIDNM… |
| A0A820AE08 | 172-341 | None |
| A0A6H5I466 | 140-282 | None |
| A0A4S8LML4 | 222-364 | None |
| A0A0S7ENQ9 | 46-192 | None |
| A0A4Z0ABK2 | 4-161 | None |
| A0A2H2IWM8 | 2-148 | None |
| A0A820RUR2 | 27-173 | None |
| A0A817SSK3 | 24-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.