DPCstruct | MC26342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 122 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 45.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4DZS4 | 110-237 | ELLKDVKETLLSLLLPWQNRLRNEIEEALDTDLLKQEAEHGALDVPHLSNYILNLMALLCAPVRDEAIQKLETIRDPVQLLRGILRV… |
| A0A0M3JF24 | 2-120 | IFEVIPEDRVRLRDEVESNLDEKLLKQQIDNGCFEVDRVTTYLVELMSRLCAPVRDEQLKKIREAENIVDILRGTCELLDQTKIDIA… |
| S4RQG1 | 3-121 | None |
| A0A2K5DMZ3 | 26-140 | None |
| A0A8B6D6S0 | 138-263 | None |
| A0A183E3H6 | 81-207 | None |
| A0A6I9MY47 | 66-194 | None |
| A0A670ZGV8 | 117-232 | None |
| A0A444T1C8 | 209-329 | None |
| A0A814LST0 | 34-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.