DPCstruct | MC26341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 76 ± 3 aa |
| Standard deviation of domain lengths | 3.49 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.52 |
| Pfam Score | 69.70 |
| Assigned Pfam label(s) | CL0123- PF19426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8SR25 | 46-118 | MEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIP |
| A0A2J8LDK2 | 92-168 | MEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTK |
| A0A164ZED2 | 363-442 | None |
| A0A6I8PH54 | 217-285 | None |
| A0A7M3RR53 | 461-539 | None |
| A0A6V7WA97 | 198-271 | None |
| B7PEJ8 | 212-291 | None |
| A0A444SH00 | 123-195 | None |
| A0A0S7JXC9 | 106-182 | None |
| A0A7E6FAK5 | 328-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.