DPCstruct | MC2634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 169 ± 15 aa |
| Standard deviation of domain lengths | 14.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661FYC2 | 507-677 | MLGERLKNVLPLRHTLMAIPDSRIREELGRLNTVVGTAANLMPQTAFVRIRSAAGDEYATLVHNNAHLNVASIFGERKQRVPDEDTL… |
| A0A2G2K6F3 | 43-208 | ADASNQFVENTGSNVSRQLQTLDNSIAATDAWINWMPELSYLLIYDKQQQLVNVSTLLRNKAHTNVSFIFGEEDRRVPLEDTMTLVP… |
| A0A090T1H7 | 198-369 | None |
| A0A3A0C1Y4 | 824-999 | None |
| A0A558HUQ4 | 661-832 | None |
| A0A1E7I3C4 | 67-249 | None |
| A0A0C4WM35 | 275-460 | None |
| A0A0B8P2Q3 | 24-175 | None |
| A0A3B1CBG8 | 1-135 | None |
| A0A090R6Q3 | 133-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.