DPCstruct | MC26339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JEP2 | 1-136 | MGCNKVHSETSRVSEYLQNLILEGNLNQFEASVVRIPIDRQDIHYVMTTCRANRLHDGIIYVYNKALSDYLSPLEEMFENLSGFVDG… |
| A0A0R3PJ37 | 421-546 | PPSIVSAYITHLASEGHFSQLQASVVRFPIHCVDIHYVMSTCKQNGLYDGIIYVMNKALGDYISPLEEMLCDVSSFASHEVLSDSEV… |
| A0A3P6RPC2 | 128-253 | None |
| A0A674I0V3 | 231-356 | None |
| A0A453N416 | 7-125 | None |
| A0A3Q0J5Z7 | 479-594 | None |
| A0A7T8K0H8 | 111-236 | None |
| A0A7D8Z266 | 312-450 | None |
| A0A6V7Y5Q9 | 169-294 | None |
| A0A3P6S9E6 | 530-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.