DPCstruct | MC26338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 142 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.42 |
| Pfam Score | 90.35 |
| Assigned Pfam label(s) | PF20659- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JE67 | 1-160 | MTAPFLRAYALASIKACHARKISAMGGMAAQIPIKNDQIANRKALAFVKQDKEREATDGHDGTWVAHPDLVKVARDVFDTTMPQQNQ… |
| A0A2X3K8A5 | 3-120 | AFIPSKDEERNNQVLNKVKADKALEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDVPITADQLLAPCDGERTEEGM… |
| A0A165A8D7 | 298-457 | None |
| A0A7W0QPD9 | 332-507 | None |
| W0RMA4 | 305-453 | None |
| A0A656C3W0 | 57-203 | None |
| A0A815PDP1 | 87-221 | None |
| A0A135S7F8 | 304-447 | None |
| A0A817D3B1 | 555-664 | None |
| A0A2J7Z1U0 | 169-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.