DPCstruct | MC26335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JD79 | 1-118 | MLVTGVILRNTGVVQLFLLKEWAMVLRKTAFVVILLRGGLGLDSDALNRLKGACLRLSFIPCSVEATVIAISSHFILKFPWLFAFAL… |
| A0A1D1VHV5 | 184-276 | LVAGFLLQNVPGIRVAAAIRPAWSSALRSIALVIILIRGGLGLDIIVLKKLSRGVALLAFLPSTVESVVVGVVAHFLLHFDWLWAFV… |
| A0A7R8ZIA6 | 47-133 | None |
| A0A1I7W9F5 | 117-228 | None |
| A0A7R9DIC9 | 135-221 | None |
| A0A7R9BC56 | 56-155 | None |
| A0A3Q4IC98 | 96-183 | None |
| A0A4W5KB96 | 1-94 | None |
| A0A7G3AT89 | 12-120 | None |
| A0A7J5XN69 | 51-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.