DPCstruct | MC26334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 1 aa |
| Standard deviation of domain lengths | 0.90 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 60.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6B422 | 344-432 | MELLRRVVVPGIRMSLKLHQDHFTSPDEYDDPSVLYEAISAHERTLVIAHEGDPAWRSAVLSNAPSLLSLRHVLNEGTNEYKIIAIE… |
| A0A423TZ38 | 479-567 | MELLRRVVAPGVRMSLKLHQDHFMLPDEYDNHESLYNAILEHEAQLVISHEGDPTWRNAVLSGKPSLLALRHVMDDGADEYKIIMLN… |
| A0A151P9C1 | 359-447 | None |
| E9PSU6 | 1846-1932 | None |
| A0A8B6DSP3 | 618-706 | None |
| A0A821D6G2 | 462-550 | None |
| Q98UF7 | 1253-1339 | None |
| A0A183PEC6 | 314-401 | None |
| A0A1L8G8K0 | 624-710 | None |
| A0A3M0KP09 | 327-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.