DPCstruct | MC26331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 142 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5D2U9 | 241-373 | RVTGPDLSRLLMNGCHVIEHRRNENQVDPKAYDRFTQFLLGGHVKEALDSAMKDGLYSDAMILARRIAINEPHELDKVETAFLSHRS… |
| A0A0M3JBN5 | 1-147 | MIQVNECLFQRVTGPDLSRLLMAGCHSFGRRAHAVAGRDKASSNTPSVCSASPQPDERNVDPRAFERFTQFLLGGHIDEAIDSALKD… |
| A0A5S6P947 | 926-1073 | None |
| A0A2H2JFA5 | 1-148 | None |
| A0A4W4DXJ8 | 149-288 | None |
| A0A183HEV5 | 238-356 | None |
| A0A0K0DL14 | 28-192 | None |
| A0A0N4UCJ8 | 274-415 | None |
| A0A158QA18 | 211-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.