DPCstruct | MC26330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 13.87 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JBP3 | 2-133 | DIALTDYHLVIIFGDRFEAISILNQKCTFNDVIAISEHGEREARAVDVWVAQSESCQLRGMCRDNVTESIWVYTDSNIIRYRPNEEG… |
| A0A811KC40 | 312-421 | VALSEYHIFLVYANKFLAMSILDQKIAFEDVFTDSSNVLGMCRDATSQLVWVFTETGLFNYRPDRETRDVWKILVERNEFSKARKIA… |
| A0A820HIX9 | 1-104 | None |
| E1ZPK9 | 376-493 | None |
| A0A7S4AD61 | 365-530 | None |
| G0MN79 | 271-385 | None |
| A0A2G3C6Q9 | 93-218 | None |
| A0A2G2XC73 | 16-129 | None |
| A0A813WFV4 | 2-109 | None |
| A0A7J7N7W9 | 96-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.