DPCstruct | MC26329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7TQ74 | 1-92 | MWSCFYYHYPHSCIVFTVLSWLLAQWCFTYIEFGLVFFLFSLFVFLFINLGKRKSGELSAYSIFNPHCERLPGTLTAEHFERDLLKR… |
| A0A0M3JBA2 | 3-113 | AFESVLCGLYRVWEGALDVYPLRAWRAYAARAPWQCAVVTLSTWLILQISAAYVQFGVVFFMFSLFIAMVLNLGERKANEPSAYSVF… |
| A0A7S0J511 | 70-192 | None |
| O01486 | 1-144 | None |
| A0A158Q806 | 107-213 | None |
| A0A7J7KUY3 | 263-388 | None |
| A0A670HL88 | 37-153 | None |
| A0A5A7PP27 | 188-323 | None |
| A0A2P5Y1B4 | 37-181 | None |
| I0YZT5 | 8-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.