DPCstruct | MC26328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JB47 | 44-115 | LEPLEAKVKQNNHKIQTPLVKLDTPGKATVQVVILADPNDHEICFVGEEAFSELSKMDAKADEMLRDAMSKD |
| A0A6G0URB8 | 132-212 | LPQLQEKVKNHDEKRVHTPLVSLDTPGKATVQVVILTDPDGHEICFVGDEAFKELSQVDPKADNLLQESIKGDWSDEWQAK |
| A0A835NW65 | 175-253 | None |
| A0A182YF04 | 213-284 | None |
| A0A1A7YMR8 | 857-939 | None |
| A0A818Q0S7 | 903-979 | None |
| A0A7S2V686 | 270-340 | None |
| A0A3P7LY89 | 136-223 | None |
| K7I5P2 | 18-89 | None |
| G1SH26 | 561-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.