DPCstruct | MC26327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 170 ± 30 aa |
| Standard deviation of domain lengths | 30.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15189 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6G8Y3 | 1-111 | MNPSRVDRLIVDMLREHARVITLVAKMENLRGDRLPDNIGVNMQCWLDAIRRVQACRREEILNSGNRRSHPLSHLRTTDEKDMAALA… |
| A0A0M3JAU8 | 2-153 | RLEECTEQYRQLEKERKKTEAELARHNLGKKISSTNNMPIPRLAQAPSRIDRLIVDFFREHARVVTLLSKMEQLRESSLPRAVHNTL… |
| A0A6L5C760 | 275-460 | None |
| A0A146KLX2 | 335-519 | None |
| A0A493TYR5 | 959-1143 | None |
| A0A816DFP4 | 147-344 | None |
| A0A673BHG5 | 1-202 | None |
| A0A2G8L2H6 | 183-376 | None |
| A0A016TIL1 | 11-136 | None |
| T1HH81 | 56-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.