DPCstruct | MC26326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 212 ± 38 aa |
| Standard deviation of domain lengths | 38.10 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.43 |
| Pfam Score | 92.24 |
| Assigned Pfam label(s) | PF16134- PF11732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3J9E7 | 2-188 | IDVIDEVLMPSVSLFEMNYAISDEIWHLLSHFPYTLRYRIYAHWKGVMTQRHSLINVQRGKTLGMTRYVVKRLSKETVRMMGRQLGK… |
| H2Z7F0 | 2-159 | VKLLPYQARYRLYGEWKNEAYDKHPELMLARAHIVDKTKYIMRRLTKENVKQTGRQMGKLSHSSPTILFDCILSQIQRYDNLIMPVV… |
| A0A1X2I7M7 | 548-737 | None |
| A0A1I8JQY3 | 12-278 | None |
| A0A2G9URE6 | 2-217 | None |
| A0A6A1V0Q6 | 862-1063 | None |
| A0A287MBQ5 | 14-224 | None |
| A6QZW3 | 746-1036 | None |
| A0A5K3FWX9 | 211-358 | None |
| H1VKN4 | 454-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.