DPCstruct | MC26322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 144 ± 12 aa |
| Standard deviation of domain lengths | 11.73 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3J800 | 1-162 | MIRSDTNHDAIDEVVYLQAYAEGWSDGKYEIKFDKRECINGGRFYERADDGKWSGWFFTYTNVRARQFSCVSIQGDSNTLADLVERD… |
| A0A183IL46 | 113-255 | VIDQLYHLQHFADWDKWEEKYDFIQCPKIPYFQATPGHWKGWFWKYDEIYASNVTCLSVMGFAKTLKPLVLSSWNTSIRSIMLDRAE… |
| A0A0M3IIU6 | 117-250 | None |
| A0A4W2GAE5 | 159-334 | None |
| A0A0D8XTA6 | 26-156 | None |
| A0A5N5T740 | 134-284 | None |
| A0A818D8G9 | 64-205 | None |
| A0A7R8W071 | 149-278 | None |
| F7AMS5 | 259-398 | None |
| A0A2H2INF0 | 14-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.