DPCstruct | MC26321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 95 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00621 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182TDP2 | 62-151 | QRGFVDFATIFTPYTKYCAEQSTCQFYCKEMYHNNALFMTYCAWCESQKMCNRLRLADILVRPMQRLTKYGLLLAAIKKHINDEAEG… |
| A0A0M3J720 | 1-100 | LDPSLLKAGFDRIDEWWPCYTTFIYGHSDCHTYVQKCQKEHELFKEFVAWAESQDTMRRQRLLDALTNPMQRLTRYSLLLKAVVKNS… |
| A0A6P9B7U2 | 155-250 | None |
| A0A067RKY0 | 12-107 | None |
| A0A182EJB8 | 48-144 | None |
| A0A182Q1V7 | 417-506 | None |
| A0A6J1WBP8 | 15-110 | None |
| A0A183CNP8 | 61-155 | None |
| A0A6A0GX83 | 115-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.