DPCstruct | MC26320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2EHP2 | 45-114 | TFRVVGRKLQDHEVVINCSIVKGLKYNQATTTFHQWRDSKFVYGLNFSSQQDAEAFARAMMHALEVLSGR |
| A0A1X7V879 | 9-77 | VFLLLTIPSRAVVFEQELYEEFHYSNPRPYFHSFPGHEFMVGLNFASEKEAEKFHAAVESGITDACTAY |
| A0A7R9CXS9 | 1-93 | None |
| A0A183WI26 | 49-142 | None |
| A0A6A5EBF8 | 32-117 | None |
| A0A0R4II01 | 27-115 | None |
| A0A1S4EFS9 | 122-210 | None |
| A0A3Q0H9X4 | 2-81 | None |
| A0A5N4C4Z9 | 7-83 | None |
| A0A444V1A7 | 115-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.