DPCstruct | MC2632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 442 ± 61 aa |
| Standard deviation of domain lengths | 61.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01508 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CHQ9 | 469-891 | NLVVSKRACIRCNSLSVYYDEQKQFCKIQEDDIKQCNSLNKQACLQMTKGIKCKWEDYECKQIDRITGSDSRDCSIYNQDACIQFQQ… |
| A0EH96 | 4-509 | NCTSYLELTECISYQGVQADCEKFVGNGMSCTNDATATSICKAKDCIKLTADSYSESVCQAYGVQCHNNGTKCDVAQSCSSLKSNLV… |
| A0CQ23 | 24-408 | None |
| A0BWG0 | 272-697 | None |
| A0D2W8 | 89-500 | None |
| Q23CK2 | 13-354 | None |
| A0CX98 | 533-967 | None |
| A0CR33 | 421-816 | None |
| A0CMT3 | 1-554 | None |
| A0C1T1 | 1-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.