DPCstruct | MC26315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 233 ± 42 aa |
| Standard deviation of domain lengths | 41.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0266- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2G484 | 77-300 | DSNRFKLIIKISLDDVEIAKDTLKVLQETEQTIDVAREDEKVIRKVIELANLIKGNKEKLMNVLEEMDSENTLRLRSLNEQMTSNPE… |
| A0A1B0DPX3 | 9-209 | RKSIKEIEYLMEDSKKLHQILAAVITLRCPHQHLEDAARELEKDLEKQLSEKQLNDGQLSVLEFTVGGNSTGSEGGQHMSIQFVNPE… |
| A0A0B1T9Q2 | 1-169 | None |
| U3ILM9 | 34-261 | None |
| A0A7J7ZRV7 | 123-419 | None |
| A0A0M3IBV9 | 1-266 | None |
| A0A077ZDG3 | 741-1021 | None |
| A0A1Y1LI38 | 306-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.