DPCstruct | MC26313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 302 ± 57 aa |
| Standard deviation of domain lengths | 56.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.05 |
| Pfam Score | 92.00 |
| Assigned Pfam label(s) | CL0165- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8ENS6 | 1-231 | MSNQDDYNKKIGKFFGTINPSLMRTMVNVSLFTSISTYDYQSLCDPKEKVKSAAGLRSIYVPSIADILNVGWWATAAAWSIVQQLLV… |
| A0A0M3IZZ7 | 68-341 | SKLKLFAFNDNNKITVTAYKQIFDSVYSRRLAVGGVQWTTEFIDRFFYNITAHRPEWAVCYQLKKSCHLVLSDGFIVAGKYSQQHLS… |
| A0A4Z2J1Z4 | 153-428 | None |
| A0A183SJ71 | 236-629 | None |
| T1FTW2 | 199-462 | None |
| A0A498P0J3 | 13-252 | None |
| T1EYA5 | 544-940 | None |
| A0A1I8ICQ4 | 216-552 | None |
| A0A016U674 | 45-414 | None |
| A0A2H2I897 | 63-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.