DPCstruct | MC2631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 341 ± 57 aa |
| Standard deviation of domain lengths | 56.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D3CUR4 | 93-354 | LSTVTKDIERRVNILLSQHEDDFFSAFRSHALNVQRHIEKLQECANAQKNLMTRDLKIKTLQQELQWFVEESVRLDQICKRLKGDLI… |
| A0EH85 | 1-365 | MFDSESFAIRNSHKSFISGKNYEDVQSQASSPHKLTRINDLKNQVENYLDMLESKVTMVKERALSEFVIAYNGYMRQVKEDLKYLKE… |
| A0A1R2CDY7 | 31-350 | None |
| A0A024FUC5 | 38-411 | None |
| A0A024UPT5 | 1-315 | None |
| F0V9L7 | 256-646 | None |
| A0A812ZA09 | 1-295 | None |
| A0A7S4E5P7 | 66-344 | None |
| J9JBK1 | 40-432 | None |
| A0A1R2AW08 | 13-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.