DPCstruct | MC26308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 125 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A293T901 | 2-99 | FVGIVRKEGNIQGLSFDIYEALLKTWFEKWRHKAKDLGVVLKMAHSLGDVLIGQSSFLCVLMGKNRKNALELYQDFIEDFKRNAPIW… |
| A0A6L7NJH1 | 48-180 | YFRITDAPLDVAAMHDLVLRPEAGAVSVFSGVVRNNNLGREVDYLEYEAYPAMACKIMRQIAEEVRARWEVCAVAMHHRRGRLEIGE… |
| A0A834BB21 | 5-147 | None |
| A0A0D2MTG3 | 172-310 | None |
| A0A535A0D5 | 7-76 | None |
| A0A4U9HK08 | 1-83 | None |
| A0A182FR39 | 4-118 | None |
| M1VAZ8 | 129-248 | None |
| A0A7R9KYC5 | 9-96 | None |
| A0A6A6KV23 | 5-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.