DPCstruct | MC26306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 238 ± 16 aa |
| Standard deviation of domain lengths | 15.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1IXS3 | 272-497 | PYQVAELVVKDTAGNVLATTRTVAPVSTEMHCEHCHNDGGKAAPGISTGVVKQNILTLHDQEEGTTLMDQRPVLCAGCHSSNALGTP… |
| A0A6L3F6F9 | 1-231 | MNCDNCHSDGGVEDISTGRVETNILTLHDMENMDEYPAGHTGALMDRRPVLCAECHESNALGKPGLDDIPSLSNAMHDTHDGEVPDT… |
| J1FBA4 | 229-497 | None |
| A0A1V5ZFC9 | 319-546 | None |
| A0A0C2V9M5 | 163-424 | None |
| A0A7V3QWI6 | 160-404 | None |
| A0A3M1EE75 | 140-381 | None |
| A0A2N2PN06 | 110-330 | None |
| A0A7V2Y460 | 627-859 | None |
| A0A855X3A0 | 143-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.