DPCstruct | MC26304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 10 aa |
| Standard deviation of domain lengths | 10.49 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D3JCI6 | 5-226 | EDELPSNLLKDKLISNINMNEIESSLKNGDGNYSVTEKLLKNFGVNLYTNYHNINKSDAVEYSQKYKSCRDINFYLDLVIALIKETK… |
| A0A1Y1JWQ2 | 13-227 | CYEYKLPSNLYKQQLLKHLYLESMKNDFELPNPYETIFFEHVDSLKANLYINYRAIVNEYCEKNQDFKCCRDINYFFNLIIAIIKTS… |
| A0A1D3JC87 | 9-216 | None |
| A0A1A8WB46 | 9-217 | None |
| A0A1A8WB29 | 112-335 | None |
| A0A1A9AFT5 | 7-220 | None |
| A0A1A8WMZ2 | 37-270 | None |
| A0A1A9ARK5 | 406-619 | None |
| A0A1Y1JR74 | 8-204 | None |
| A0A1Y1JDA1 | 6-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.