DPCstruct | MC263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X1ABK1 | 6-99 | KDLIVEVLHMGEGDETFITAISGRITVERLQEIEKQMADGEAFEKGAGSYVFDCAYFPGQYGEFGYCELPPCWELTPIGFVCLEQLV… |
| A0A1S2UEF8 | 10-98 | KKDLVVKVFLLDDGDDPFICAVNGEIGLHGLTMIEEQLSWDHEFSRGPGEYIYEAAYDDGQYDEMGRCEIRPFWELTEISFEKHPEP… |
| A0A010TGQ6 | 88-182 | None |
| A0A7Y1G5P2 | 175-269 | None |
| A0A1E4WD66 | 148-243 | None |
| A5W5V8 | 27-116 | None |
| A0A3M5Z8K7 | 260-359 | None |
| A0A4R1ZK35 | 89-187 | None |
| A0A7T8IFU9 | 2-109 | None |
| A0A3N7CS92 | 106-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.