DPCstruct | MC26297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 482 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 15.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.79 |
| Pfam Score | 91.40 |
| Assigned Pfam label(s) | CL0110- CL0344- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A823RMD9 | 134-248 | NIKDSFDIEIKYINDVLSRYKNIGIYGAGVQGHTLINHLNYKNLLKIVCAFEINRDKVGKYMVNSNILINYPDRKSLEKLDCLIMAI… |
| A0A845ZSI5 | 35-147 | VKNFTNEISKKLENWRQHLEQMHAEGKRVVVWGSGSKCVAFLTTLDTTDKIEYVVDINPHRHGKFIPGVGKKIMAPEFLKEYKPDQV… |
| A0A1G5KDV2 | 412-517 | None |
| A0A2G8LHF0 | 190-307 | None |
| A0A4R2KF21 | 1-88 | None |
| A0A0A7RGX5 | 16-124 | None |
| A0A0D4BWD7 | 3-151 | None |
| A0A7J4J992 | 295-402 | None |
| A0A7X3SJ34 | 5-123 | None |
| A0A258KLH5 | 72-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.