DPCstruct | MC26291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811UR62 | 1-98 | MSGQQKCSLRAKPKPLVVSPQQVMILYMHKLTPYERTEILAYPQISLLEQMQRNVLGAYLHIPHDHVAYRYEMLKVIGKGSFGQVIK… |
| A0A1D2M5S3 | 1-101 | MSLQEAFDKYGFKLSSFETREIFRYSQIYFVGEKATKINGGIDLRDTSRFDDEYGFYRFVPEDHLAYRYELVKPLGKGTTAQVFSAV… |
| A0A401S276 | 6-81 | None |
| A0A1A9VTM4 | 2-74 | None |
| A0A2C9JKR8 | 15-132 | None |
| A0A0V0QXD4 | 151-261 | None |
| A0A0D6LXL2 | 88-212 | None |
| A0A813JXX5 | 1-73 | None |
| A0A498MTT4 | 106-206 | None |
| I1BXC9 | 250-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.