DPCstruct | MC2629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Standard deviation of domain lengths | 18.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7MMM1 | 5-103 | KKFTPDDVRAFTKPTEQFLCPLSANHYNIQFLDFRIRDVETNKVFFQISREQADEEELKALEQQELSPEEEIEMRTVRYHFGNNFFD… |
| A0ECH8 | 4-98 | VTTEYVRSLNGITQDFLCPVNANIYNIQFLKFRIRDMDSGQTLFEVERDQDEEPIGKIINQTQQENLPPEYQDEARRIKYHFGPQFF… |
| A0A3P8FXZ2 | 1-91 | None |
| A0A4Z2G795 | 36-120 | None |
| A0A813F0U9 | 92-221 | None |
| A0A5N4D8N6 | 17-121 | None |
| A0A6J3I2V7 | 29-102 | None |
| A0A7R8CLN7 | 5-116 | None |
| A0A482URS5 | 1-88 | None |
| A0A3P8WZ75 | 17-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.