DPCstruct | MC26288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 264 ± 25 aa |
| Standard deviation of domain lengths | 25.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9F3Y0 | 203-460 | PSIIIETFGPTIQIAVARLEHMDDKELKCETVKGDLNESPYVELAKVLQSLLLINPEMIHLGRQMPFFSLRYILRVLQVAPFAGRIA… |
| A0A811UFW2 | 3-227 | IWNVVLDLLDSFSDDELKREAKPEGRNDYINGIVKSARLLASRLPGQEDLIRDLEMFRLKMILRLLQVSSFNGKMNALNEINKVLSS… |
| A0A818CFT4 | 274-571 | None |
| A0A132AFI7 | 20-313 | None |
| A0A6J8ENW6 | 76-329 | None |
| A0A0V0QNV4 | 317-605 | None |
| A0A3Q0IN32 | 2-246 | None |
| A0A819JKZ3 | 264-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.