DPCstruct | MC26286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 223 ± 32 aa |
| Standard deviation of domain lengths | 32.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.21 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0210- PF18136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9Y767 | 71-291 | EHLYKQLFPRGNTDPPAPELIELAKDHLARHDLLGKTTDKTPPIAFQLPALVGDTLDEHFHKLGVDAAEPFLTHAKQFADAHLPPKP… |
| A0A811UC72 | 35-302 | KTKLIQPAVTNNKIDVTNETTTAQSEINNDFAENVVKETENYIAALKKHGIDVTSTDRLEDVNMILPKLHGKNIEEHFYTIAKEQVA… |
| A0A0N4VX39 | 1-177 | None |
| A0A1I8IRQ6 | 134-336 | None |
| A0A1S8W1C9 | 129-382 | None |
| A0A0D8Y0Y4 | 207-404 | None |
| A0A2J8VX18 | 26-317 | None |
| A0A6J3C2B8 | 12-227 | None |
| A0A1E3P2S7 | 5-172 | None |
| T1FA09 | 49-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.