DPCstruct | MC26285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 55 ± 3 aa |
| Standard deviation of domain lengths | 2.60 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 62.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811U7R8 | 1-58 | MFKCIPIFKGCNRQVEFVDKRHCSLPSVPEEILRYSRTLEELFLDANHIRDLPKVRAF |
| A0A2U3YZQ7 | 1-52 | MFHCIPLWRCNRHVETIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELP |
| A0A0N5B197 | 2-54 | None |
| A0A2I0TN16 | 45-101 | None |
| A0A498NDD3 | 1-52 | None |
| A0A4Z2H6K6 | 1-57 | None |
| A0A5N3WD80 | 1-52 | None |
| A0A1B0G6N8 | 1-58 | None |
| A0A2R7W3F1 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.