DPCstruct | MC26283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 62.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9PHK8 | 112-186 | MSEVVQAYETLHANLPPTLAKSQVSSVRKNLKLHLVAVLKHPCSLEFQGQISTLLLDLGMAQSEITRSTPAPREQ |
| A0A7R9FDU5 | 38-108 | MGRVIAAMETLHTNLPPTLSKSQVSSVRKHLKMQLLNLLKHAASIDYHNNITTLLTDLGATHQEVNNTDTV |
| A0A672K8Y2 | 79-152 | None |
| T1F0X8 | 203-280 | None |
| A0A818F3H6 | 1-68 | None |
| A0A183GFI8 | 166-233 | None |
| A0A3P7JYQ7 | 2-61 | None |
| A0A315VTP8 | 119-193 | None |
| A0A671P8T0 | 29-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.