DPCstruct | MC26281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 148 ± 13 aa |
| Standard deviation of domain lengths | 13.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3C3E8 | 4-156 | KTYNDLLCETSEILVEATQADEAIFEAGATERTVLQPLLSEIRIRYTVLLARLDTVYDQLLQPQKRIIVRRLLEGCLGRLIEIKHDL… |
| A0A482W9U5 | 5-141 | YYSKWWAGTKHNLEKLIQKDAELVKMTNQRVKDRTLANQLVGGLYAKYSMLVQDLGTILDQMAQPQKRIIVRKLMDAATVRLHELNE… |
| S7NID1 | 3-123 | None |
| A0A7F8RMP0 | 7-125 | None |
| A0A091DJZ8 | 85-246 | None |
| A0A2C9K6B4 | 38-179 | None |
| A0A814PW24 | 4-151 | None |
| A0A6A4VU45 | 26-176 | None |
| A0A183S088 | 89-244 | None |
| W6KX48 | 2-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.