DPCstruct | MC26280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 412 |
|---|---|
| Mean domain length (aa) | 165 ± 32 aa |
| Standard deviation of domain lengths | 32.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 18.16 |
| Pfam Score | 98.80 |
| Assigned Pfam label(s) | PF01161- PF07760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A133VDU7 | 3-152 | LSSSAFENGKEIPSKYTCEGDDVSPPLSIEEVDPGTESLALVVDDPDAPGRVFDHWIIWNIPADADSIPEGVPPDEIVESLDGAIQG… |
| A0A482W1W3 | 15-166 | PPLKISITYQSRNVEPGQELTPIEVKDEPAARWEANPAKYYTLVMFDPDAPSREDPKLADVKHWLVGNILGCEVSTGDVIAEYFGSG… |
| A0A5C8CAW7 | 13-166 | None |
| A0A0D8XEK9 | 1-320 | None |
| A0A7R8WY22 | 103-271 | None |
| A0A1H1XZT0 | 299-459 | None |
| A0A146H775 | 313-486 | None |
| A0A7S2UZW4 | 33-182 | None |
| A0A821U7L6 | 43-212 | None |
| A0A1S1MLK8 | 371-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.