DPCstruct | MC2628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 736 ± 49 aa |
| Standard deviation of domain lengths | 49.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0029- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y6CK72 | 6-699 | KIKLAPGLYWLEVKDANLRILCGCPSDSVKFMLKRGLIKQMESHGLAFESGPNAILLSDLSIQKGDLCNLAEFPILQMFYRQGFLIP… |
| A0E1L2 | 44-851 | PILLKSESQFSESDISNKIKLPRGGSIVMTKAGAIQFSMVPETLKDSINLGLDVPGIFIVPSHRFDKRFCLSVAEFEFPAYFSFFVK… |
| A0A024GN46 | 1-807 | None |
| A0A7S4DX97 | 1-692 | None |
| A0A2P6N293 | 113-915 | None |
| A0A3D6C5V1 | 2-722 | None |
| A0A349MJH6 | 153-917 | None |
| A0A1G3YVC3 | 3-681 | None |
| G0QTG6 | 299-1056 | None |
| G0QK55 | 21-715 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.