DPCstruct | MC26278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 193 ± 54 aa |
| Standard deviation of domain lengths | 54.44 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.63 |
| Pfam Score | 98.94 |
| Assigned Pfam label(s) | CL0237- CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9XHT5 | 52-285 | PEYDWPHKGNLSTFDHASLRRGYQVYREVCSSCHSLSLVAWRTLVGVTHTSDEVREMASEFEYDDEPDDEGNPRKRAGKLADYMPEP… |
| A0A812K430 | 355-532 | KVLASEIEVEDGPDDDGEMFERPGKLNDAFPSPYANEEQARSINNGALPPDLSLITKARHDGDNYLFALLTGYKEAPAGVVVNEEAG… |
| A0A3M7DCY7 | 81-292 | None |
| A0A4R6YBR5 | 40-289 | None |
| A0A0D3C0A7 | 71-207 | None |
| A0A830C867 | 58-261 | None |
| A0A0A2V4R1 | 626-865 | None |
| A0A553IDD3 | 384-614 | None |
| A0A2A2KA94 | 25-208 | None |
| A0A7S2JUP8 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.