DPCstruct | MC26274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 223 |
|---|---|
| Mean domain length (aa) | 194 ± 41 aa |
| Standard deviation of domain lengths | 40.90 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376MTF6 | 40-240 | VKFGTSGHRGSAARHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAANGVDVIVQENNGFTPTPAISNA… |
| A0A353M0I8 | 63-217 | IAGDIRGNLTPEIVTQLGFSYAAFLGGKSRVLVTSDVSKVADLAKRALVVGLRGGGLDTHDGGDAAGRMTRSAVQEMALDGALHVGV… |
| U1PBB7 | 1-200 | None |
| A0A1V2LGQ6 | 43-250 | None |
| A0A0D3CJL7 | 83-237 | None |
| M1V875 | 113-386 | None |
| A0A3E1K715 | 586-800 | None |
| A0A3E1K719 | 381-568 | None |
| A0A0B8NPR1 | 6-184 | None |
| A0A6G3V3V3 | 40-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.