DPCstruct | MC26267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08984 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6J1A2 | 28-103 | IIIKTININTSIHDLVKSYPEIKDIMKNLGFDNIVNPVMLNTVGRIMTIKKGSEMKNISLDKIKEAFLENNFILED |
| A0A7C6M5E0 | 1-74 | MRKSINADWTVSKIVSTVPEAKEILKNLGFNDIANPIMLNTAGKIMTLRKGALMKKIDINKIKDEFNNHDIDLE |
| A0A412KNV6 | 1-73 | None |
| A0A139NZQ1 | 7-85 | None |
| A0A316LFE9 | 1-76 | None |
| A0A1D7QYC6 | 1-78 | None |
| A0A4Y3JUT0 | 109-184 | None |
| A0A7T9HAU2 | 99-160 | None |
| A0A7V4MYD8 | 28-104 | None |
| A0A5C8EHU8 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.