DPCstruct | MC26266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7U5Y2 | 361-490 | VLEQAAAVESWQRVRFTATEGSVLTQGPGGVARTDAVPYDVPGFNPVYATWEALASGNRARLRFDTGTQALHRPLVVLRGYTAATPP… |
| X0XIX6 | 1-137 | MLHGMTDKPAAKLVPLAKSWLYAPQLKLNGEGYVSEGYDQAQRAYVFARRDVRKPSALEFELAASEESPVVNPAFVIKNWRRGRASL… |
| A0A352FCF6 | 486-606 | None |
| A0A7T9DEL4 | 347-488 | None |
| A0A565EAD6 | 308-432 | None |
| A0A7C8EKJ0 | 411-543 | None |
| A0A7C8AJ81 | 98-221 | None |
| A0A7C8ABQ6 | 340-472 | None |
| A0A3C1R1C9 | 1-155 | None |
| A0A2E0XJR0 | 4-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.