DPCstruct | MC26262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 259 |
|---|---|
| Mean domain length (aa) | 153 ± 37 aa |
| Standard deviation of domain lengths | 37.45 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 96.14 |
| Assigned Pfam label(s) | PF18823- CL0056- CL0124- PF00719- PF01124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1CPR5 | 8-132 | VDPATRDVVIEVSRGGFVKWGADGSVDFVSPVPCPFNYGSLPGLCGADGDPLDALVLGPTLRRGRTLSCAVVGRVRFVDDGVVDDKW… |
| A0A4Z2C6U8 | 28-193 | ISPFHDIPMFADESQNIFHMVVEVPRWTNAKMEIATKDLLNPIKQDEKKGKLRYVANVFPHKGYIWNYGAIPQTWEDPSHKDGDTGC… |
| A0A445CQ74 | 111-244 | None |
| A0A6A6L7S7 | 47-231 | None |
| A0A7L5XYR9 | 10-173 | None |
| A0A449BKQ1 | 6-167 | None |
| A0A811MCM0 | 484-656 | None |
| A0A1V2LHV9 | 358-569 | None |
| F8CBU7 | 9-106 | None |
| A0A1T4KNF2 | 361-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.