DPCstruct | MC2626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 138 ± 42 aa |
| Standard deviation of domain lengths | 41.68 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0233 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662NZV7 | 173-259 | DYRGVSEYKSKGGLIRCRCSVSEGKISEIKISGDFFLYPEEAITQLEDHLTGSRASYIHIASILEEFWDKIRESPGLCPRDLALAIS |
| A0A0P0N5B5 | 159-272 | PRTSLQELATLFESQQWREYIYHRGDAEAERRREGGYWIRISIETTDGYVTGYWLTGVFFSAPPTEVYNVLNSLRGARFHELMLYNI… |
| A0A7J2HF35 | 3-80 | None |
| A0A437UTQ9 | 290-435 | None |
| A0A7J6KWI4 | 37-153 | None |
| A0A497T1D2 | 25-144 | None |
| Q2GNE8 | 229-457 | None |
| H8I4P4 | 3-84 | None |
| U6LIC3 | 114-318 | None |
| A0A1F4AD04 | 54-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.