DPCstruct | MC26258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0SA81 | 65-130 | ANTHLIPANKVVAQKLADIDVDDMVYLKGQLVEVKSTDGWTWRSSLSRIDTGNGACELMLVEEVRE |
| A0A3D0H3F7 | 1-65 | MHMLPATNEIKSRLFSLRRGNVIEMTGYLVGIQEDGQWTWMSSLSRTDTGDGACEIVWVETLKVR |
| A0A838FPL1 | 50-115 | None |
| A0A257UA93 | 435-509 | None |
| A0A7C0WY85 | 25-100 | None |
| A0A350AV13 | 94-169 | None |
| A0A7T0NZQ6 | 2-70 | None |
| A0A1V5PUV0 | 11-81 | None |
| A0A2K8U923 | 69-138 | None |
| A0A2T6DGV0 | 128-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.