DPCstruct | MC26253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 68 ± 3 aa |
| Standard deviation of domain lengths | 3.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671XCP4 | 1-71 | LASYTTRFGQKVNPAFKDKVGFTDAGLQNSSIFIRNVTEEDEGCYLCLFNADPEGALIGTTCLQVYVGRLQ |
| A0A1S3R3K1 | 23-85 | ATYSKRGSNVNLRFQGKVEFEDEGLQNCSIVIRGVSRGDESCYKCLFNTFPEGPISGRTCLHV |
| A0A2D0Q3Z1 | 1-65 | None |
| H3A6C4 | 29-93 | None |
| A0A672UHX3 | 1-72 | None |
| A0A3Q1K4I6 | 1-66 | None |
| A0A2I0TX99 | 42-105 | None |
| A0A672YL51 | 20-91 | None |
| A0A2Y9QTE5 | 1-68 | None |
| A0A3P9D4T2 | 36-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.