DPCstruct | MC26250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 208 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A292RT12 | 7-190 | TGTNKTGWVVIPSKKNNPDNFEANVDKLKTLSYKTWCTKSFNAEPYLSEGDFHVYLENGQPKLGVRFVDGAVKEIQGVLNNGKIPLN… |
| A0A0G1JKL1 | 278-481 | STEGLKETRGQWRKFPQGSKPDELVKSLGGYPLEWCTADPDTARTQLQGGDFYVYYSFNEDGQPVIPRLAIRMEGKNKIAESPRGIA… |
| A0A1F6WHY2 | 242-451 | None |
| A0A4Q6CL32 | 274-478 | None |
| A0A2T2QYU6 | 88-311 | None |
| A0A857VFP6 | 342-542 | None |
| A0A849WSS8 | 290-517 | None |
| A0A1F5NTS7 | 259-468 | None |
| A0A2H0UNU1 | 176-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.